Lineage for d1yw0c_ (1yw0 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016335Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 2016336Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) (S)
    contains heme-dependent enzymes
  5. 2016337Family a.266.1.1: Bacterial tryptophan 2,3-dioxygenase [140960] (2 protein domains)
    Pfam PF03301
  6. 2016341Protein automated matches [190841] (1 species)
    not a true protein
  7. 2016342Species Xanthomonas campestris [TaxId:190485] [188157] (1 PDB entry)
  8. 2016344Domain d1yw0c_: 1yw0 C: [124128]
    Other proteins in same PDB: d1yw0a1
    automated match to d1yw0a1
    complexed with mg

Details for d1yw0c_

PDB Entry: 1yw0 (more details), 2.7 Å

PDB Description: Crystal structure of the tryptophan 2,3-dioxygenase from Xanthomonas campestris. Northeast Structural Genomics Target XcR13.
PDB Compounds: (C:) Tryptophan 2,3-dioxygenase

SCOPe Domain Sequences for d1yw0c_:

Sequence, based on SEQRES records: (download)

>d1yw0c_ a.266.1.1 (C:) automated matches {Xanthomonas campestris [TaxId: 190485]}
tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw
qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefllgnkn
pqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtl
rpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgf
lqqalaltffpelfdvrtsvgv

Sequence, based on observed residues (ATOM records): (download)

>d1yw0c_ a.266.1.1 (C:) automated matches {Xanthomonas campestris [TaxId: 190485]}
tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw
qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgfqslqyryiefllgnknpqml
qvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtlrpvf
eriyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfalaltffpelfdvrts
vgv

SCOPe Domain Coordinates for d1yw0c_:

Click to download the PDB-style file with coordinates for d1yw0c_.
(The format of our PDB-style files is described here.)

Timeline for d1yw0c_: