![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily) multihelical; bundle, contains interrupted helices |
![]() | Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) ![]() contains heme-dependent enzymes |
![]() | Family a.266.1.1: Bacterial tryptophan 2,3-dioxygenase [140960] (2 proteins) Pfam PF03301 |
![]() | Protein automated matches [190841] (1 species) not a true protein |
![]() | Species Xanthomonas campestris [TaxId:190485] [188157] (1 PDB entry) |
![]() | Domain d1yw0b_: 1yw0 B: [124127] Other proteins in same PDB: d1yw0a1 automated match to d1yw0a1 complexed with mg |
PDB Entry: 1yw0 (more details), 2.7 Å
SCOPe Domain Sequences for d1yw0b_:
Sequence, based on SEQRES records: (download)
>d1yw0b_ a.266.1.1 (B:) automated matches {Xanthomonas campestris [TaxId: 190485]} tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefllgnkn pqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtl rpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgf lqqalaltffpelfdvrtsvgv
>d1yw0b_ a.266.1.1 (B:) automated matches {Xanthomonas campestris [TaxId: 190485]} tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgfqslqyryiefllgnknpqml qvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtlrpvf eriyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigflaltffpelfdvrtsv gv
Timeline for d1yw0b_: