Lineage for d1yw0a1 (1yw0 A:23-284)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016335Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 2016336Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) (S)
    contains heme-dependent enzymes
  5. 2016337Family a.266.1.1: Bacterial tryptophan 2,3-dioxygenase [140960] (2 protein domains)
    Pfam PF03301
  6. Protein Tryptophan 2,3-dioxygenase [140961] (1 species)
  7. Species Xanthomonas campestris pv. campestris [TaxId:340] [140962] (1 PDB entry)
    Uniprot Q8PDA8 23-284
  8. 2016340Domain d1yw0a1: 1yw0 A:23-284 [124126]
    Other proteins in same PDB: d1yw0b_, d1yw0c_, d1yw0d_
    complexed with mg

Details for d1yw0a1

PDB Entry: 1yw0 (more details), 2.7 Å

PDB Description: Crystal structure of the tryptophan 2,3-dioxygenase from Xanthomonas campestris. Northeast Structural Genomics Target XcR13.
PDB Compounds: (A:) Tryptophan 2,3-dioxygenase

SCOPe Domain Sequences for d1yw0a1:

Sequence, based on SEQRES records: (download)

>d1yw0a1 a.266.1.1 (A:23-284) Tryptophan 2,3-dioxygenase {Xanthomonas campestris pv. campestris [TaxId: 340]}
tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw
qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefllgnkn
pqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtl
rpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgf
lqqalaltffpelfdvrtsvgv

Sequence, based on observed residues (ATOM records): (download)

>d1yw0a1 a.266.1.1 (A:23-284) Tryptophan 2,3-dioxygenase {Xanthomonas campestris pv. campestris [TaxId: 340]}
tyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahelraaivhlqrdevw
qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgfqslqyryiefllgnknpqml
qvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtlrpvf
eriyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfalaltffpelfdvrts
vgv

SCOPe Domain Coordinates for d1yw0a1:

Click to download the PDB-style file with coordinates for d1yw0a1.
(The format of our PDB-style files is described here.)

Timeline for d1yw0a1: