SCOPe 2.07: Domain d1yvwd_: 1yvw D:

Lineage for d1yvwd_ (1yvw D:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
   Pfam PF01503

6. Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species)

7. Species Bacillus cereus [TaxId:1396] [140802] (1 PDB entry)
   Uniprot Q81G00 4-95

8. Domain d1yvwd_: 1yvw D: [124125]
   automated match to d1yvwa1

Details for d1yvwd_

PDB Entry: 1yvw, 2.6 Å

PDB Description: Crystal structure of Phosphoribosyl-ATP pyrophosphohydrolase from Bacillus cereus. NESGC target BcR13.

PDB Compounds: (D:) Phosphoribosyl-ATP pyrophosphatase

SCOPe Domain Sequences for d1yvwd_:

Sequence; same for both SEQRES and ATOM records:

>d1yvwd_ a.204.1.4 (D:) Phosphoribosyl-ATP pyrophosphatase HisE {Bacillus cereus [TaxId: 1396]}
afkllyktieerkgsplpesytnylfskgedkilkkigeecaeviiacknndkeevvkem
vdvfyhcfvllaeknialedvmrevkerngkl

Timeline for d1yvwd_:

• d1yvwd_ first appeared in SCOP 1.73, called d1yvwd1
  
• d1yvwd_ appears in SCOPe 2.06
  
• d1yvwd_ appears in the current release, SCOPe 2.08