SCOP 1.73: Domain d1yvwd1: 1yvw D:4-95

Lineage for d1yvwd1 (1yvw D:4-95)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
   Pfam PF01503

6. Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (4 species)

7. Species Bacillus cereus [TaxId:1396] [140802] (1 PDB entry)

8. Domain d1yvwd1: 1yvw D:4-95 [124125]
   automatically matched to 1YVW A:4-95

Details for d1yvwd1

PDB Entry: 1yvw, 2.6 Å

PDB Description: Crystal structure of Phosphoribosyl-ATP pyrophosphohydrolase from Bacillus cereus. NESGC target BcR13.

PDB Compounds: (D:) Phosphoribosyl-ATP pyrophosphatase

SCOP Domain Sequences for d1yvwd1:

Sequence; same for both SEQRES and ATOM records:

>d1yvwd1 a.204.1.4 (D:4-95) Phosphoribosyl-ATP pyrophosphatase HisE {Bacillus cereus [TaxId: 1396]}
afkllyktieerkgsplpesytnylfskgedkilkkigeecaeviiacknndkeevvkem
vdvfyhcfvllaeknialedvmrevkerngkl

Timeline for d1yvwd1:

• d1yvwd1 is new in SCOP 1.73
  
• d1yvwd1 appears in SCOP 1.75
  
• d1yvwd1 appears in the current release, SCOPe 2.08, called d1yvwd_