Lineage for d1yvwc1 (1yvw C:4-95)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651014Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 651015Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 651055Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
    Pfam PF01503
  6. 651056Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (4 species)
  7. 651057Species Bacillus cereus [TaxId:1396] [140802] (1 PDB entry)
  8. 651060Domain d1yvwc1: 1yvw C:4-95 [124124]
    automatically matched to 1YVW A:4-95

Details for d1yvwc1

PDB Entry: 1yvw (more details), 2.6 Å

PDB Description: Crystal structure of Phosphoribosyl-ATP pyrophosphohydrolase from Bacillus cereus. NESGC target BcR13.
PDB Compounds: (C:) Phosphoribosyl-ATP pyrophosphatase

SCOP Domain Sequences for d1yvwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvwc1 a.204.1.4 (C:4-95) Phosphoribosyl-ATP pyrophosphatase HisE {Bacillus cereus [TaxId: 1396]}
afkllyktieerkgsplpesytnylfskgedkilkkigeecaeviiacknndkeevvkem
vdvfyhcfvllaeknialedvmrevkerngkl

SCOP Domain Coordinates for d1yvwc1:

Click to download the PDB-style file with coordinates for d1yvwc1.
(The format of our PDB-style files is described here.)

Timeline for d1yvwc1: