Lineage for d1yvua2 (1yvu A:315-706)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995888Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 996500Family c.55.3.10: PIWI domain [110640] (3 proteins)
    Pfam PF02171
  6. 996501Protein Argonaute homologue Aq_1447 [142501] (1 species)
    includes the middle domain
  7. 996502Species Aquifex aeolicus [TaxId:63363] [142502] (4 PDB entries)
    Uniprot O67434 315-706
  8. 996503Domain d1yvua2: 1yvu A:315-706 [124121]
    Other proteins in same PDB: d1yvua1
    complexed with ca

Details for d1yvua2

PDB Entry: 1yvu (more details), 2.9 Å

PDB Description: Crystal structure of A. aeolicus Argonaute
PDB Compounds: (A:) hypothetical protein aq_1447

SCOPe Domain Sequences for d1yvua2:

Sequence, based on SEQRES records: (download)

>d1yvua2 c.55.3.10 (A:315-706) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]}
klnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvykklewrkeeflk
elinflknkgiklkikgkslilaqtreeakeklipvinkikdvdlvivfleeypkvdpyk
sfllydfvkrellkkmipsqvilnrtlknenlkfvllnvaeqvlaktgnipyklkeiegk
vdafvgidisritrdgktvnavaftkifnskgelvryyltsypafgekltekaigdvfsl
leklgfkkgskivvhrdgrlyrdevaafkkygelygyslelleiikrnnprffsnekfik
gyfyklsedsvilatynqvyegthqpikvrkvygelpvevlcsqilsltlmnyssfqpik
lpatvhysdkitklmlrgiepikkegdimywl

Sequence, based on observed residues (ATOM records): (download)

>d1yvua2 c.55.3.10 (A:315-706) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]}
klnfkdtvldakgkntkvitnlrkflelcrpfvkkdvlsveiisvsvwrkeeflkelinf
lknkgiklkikgkslilaqtreeakeklipvinkikdvdlvivflefllydfvkrellkk
mipsqvilnrtlknenlkfvllnvaeqvlaktgnipyklkeiegkvdafvgidisritrd
gktvnavaftkifnskgelvryyltsypafgekltekaigdvfslleklgfkkgskivvh
rdgrlyrdevaafkkygelygyslelleiikrnnprffsnekfikgyfyklsedsvilat
ynqvyegthqpikvrkvygelpvevlcsqilsltlmnyssfqpiklpatvhysdkitklm
lrgiepikkegdimywl

SCOPe Domain Coordinates for d1yvua2:

Click to download the PDB-style file with coordinates for d1yvua2.
(The format of our PDB-style files is described here.)

Timeline for d1yvua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yvua1