Lineage for d1yvua1 (1yvu A:4-314)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047718Superfamily b.34.14: PAZ domain [101690] (2 families) (S)
  5. 2047719Family b.34.14.1: PAZ domain [101691] (6 protein domains)
  6. 2047736Protein Argonaute homologue Aq_1447 [141227] (1 species)
    includes the N-terminal domain
  7. 2047737Species Aquifex aeolicus [TaxId:63363] [141228] (2 PDB entries)
    Uniprot O67434 4-314
  8. 2047738Domain d1yvua1: 1yvu A:4-314 [124120]
    Other proteins in same PDB: d1yvua3, d1yvua4
    complexed with ca

Details for d1yvua1

PDB Entry: 1yvu (more details), 2.9 Å

PDB Description: Crystal structure of A. aeolicus Argonaute
PDB Compounds: (A:) hypothetical protein aq_1447

SCOPe Domain Sequences for d1yvua1:

Sequence, based on SEQRES records: (download)

>d1yvua1 b.34.14.1 (A:4-314) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]}
eallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwcagkv
ekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfykkfr
dkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnpkri
rvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaflvv
lekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrdygw
yispeeerakg

Sequence, based on observed residues (ATOM records): (download)

>d1yvua1 b.34.14.1 (A:4-314) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]}
eallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwcagkv
ekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfykkfr
dkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnpkri
rvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaflvv
lekgytypatilkpvltyernevadivrmepgkrlnliryilrryvkalrdygwyispee
erakg

SCOPe Domain Coordinates for d1yvua1:

Click to download the PDB-style file with coordinates for d1yvua1.
(The format of our PDB-style files is described here.)

Timeline for d1yvua1: