![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
![]() | Family c.62.1.5: RoRNP C-terminal domain-like [142565] (1 protein) |
![]() | Protein 60-kda SS-A/Ro ribonucleoprotein, RoRNP [142566] (1 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [142567] (3 PDB entries) Uniprot P42700 364-537 |
![]() | Domain d1yvra2: 1yvr A:364-537 [124117] Other proteins in same PDB: d1yvra1 automated match to d1yvpa2 |
PDB Entry: 1yvr (more details), 1.95 Å
SCOPe Domain Sequences for d1yvra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} veptgkrfllaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdemlpcp itvnmllhevvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpatal kqyrekmgipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldl
Timeline for d1yvra2: