![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (22 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46501] (173 PDB entries) |
![]() | Domain d1yvqd1: 1yvq D:1-146 [124115] Other proteins in same PDB: d1yvqa1, d1yvqc1 automatically matched to d1nqpb_ complexed with cmo, hem; mutant |
PDB Entry: 1yvq (more details), 1.8 Å
SCOP Domain Sequences for d1yvqd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvqd1 a.1.1.2 (D:1-146) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} vhltpeeksavtalwgkvnvdevggkalgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d1yvqd1: