Lineage for d1yvpa2 (1yvp A:364-537)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839328Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 839329Superfamily c.62.1: vWA-like [53300] (5 families) (S)
  5. 839470Family c.62.1.5: RoRNP C-terminal domain-like [142565] (1 protein)
  6. 839471Protein 60-kda SS-A/Ro ribonucleoprotein, RoRNP [142566] (1 species)
  7. 839472Species African clawed frog (Xenopus laevis) [TaxId:8355] [142567] (3 PDB entries)
    Uniprot P42700 364-537
  8. 839474Domain d1yvpa2: 1yvp A:364-537 [124109]
    Other proteins in same PDB: d1yvpa1, d1yvpb1
    complexed with act, iu, mg

Details for d1yvpa2

PDB Entry: 1yvp (more details), 2.2 Å

PDB Description: Ro autoantigen complexed with RNAs
PDB Compounds: (A:) 60-kDa SS-A/Ro ribonucleoprotein

SCOP Domain Sequences for d1yvpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvpa2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]}
veptgkrfllaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdemlpcp
itvnmllhevvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpatal
kqyrekmgipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldl

SCOP Domain Coordinates for d1yvpa2:

Click to download the PDB-style file with coordinates for d1yvpa2.
(The format of our PDB-style files is described here.)

Timeline for d1yvpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yvpa1