SCOPe 2.05: Domain d1yvoa1: 1yvo A:4-172

Lineage for d1yvoa1 (1yvo A:4-172)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Hypothetical protein PA4866 [143694] (1 species)
   Putative phosphinothricin acetyltransferase

7. Species Pseudomonas aeruginosa [TaxId:287] [143695] (5 PDB entries)
   Uniprot Q9HUU7 3-172! Uniprot Q9HUU7 4-172

8. Domain d1yvoa1: 1yvo A:4-172 [124106]
   Other proteins in same PDB: d1yvob_

Details for d1yvoa1

PDB Entry: 1yvo, 1.9 Å

PDB Description: hypothetical acetyltransferase from P.aeruginosa PA01

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1yvoa1:

Sequence; same for both SEQRES and ATOM records:

>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]}
sirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdtrarqgypilvasdaag
evlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaai
esgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap

Timeline for d1yvoa1:

• d1yvoa1 first appeared in SCOP 1.73
  
• d1yvoa1 appears in SCOPe 2.04
  
• d1yvoa1 appears in SCOPe 2.06
  
• d1yvoa1 appears in the current release, SCOPe 2.08