Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
Protein Hypothetical protein PA4866 [143694] (1 species) Putative phosphinothricin acetyltransferase |
Species Pseudomonas aeruginosa [TaxId:287] [143695] (5 PDB entries) Uniprot Q9HUU7 3-172! Uniprot Q9HUU7 4-172 |
Domain d1yvoa1: 1yvo A:4-172 [124106] Other proteins in same PDB: d1yvob_ |
PDB Entry: 1yvo (more details), 1.9 Å
SCOPe Domain Sequences for d1yvoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} sirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdtrarqgypilvasdaag evlgyasygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaai esgnaasiglhrrlgfeisgqmpqvgqkfgrwldltfmqlnldptrsap
Timeline for d1yvoa1: