Lineage for d1yvma_ (1yvm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974613Protein Methionine aminopeptidase [55924] (7 species)
  7. 2974624Species Escherichia coli [TaxId:562] [55925] (32 PDB entries)
    Uniprot P07906
  8. 2974625Domain d1yvma_: 1yvm A: [124105]
    automated match to d3mata_
    complexed with co, na, tmg

Details for d1yvma_

PDB Entry: 1yvm (more details), 1.6 Å

PDB Description: e. coli methionine aminopeptidase in complex with thiabendazole
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d1yvma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvma_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigqgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishd

SCOPe Domain Coordinates for d1yvma_:

Click to download the PDB-style file with coordinates for d1yvma_.
(The format of our PDB-style files is described here.)

Timeline for d1yvma_: