Lineage for d1yvkd2 (1yvk D:5-155)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209391Protein Hypothetical protein YvbK (BSu33890) [143706] (1 species)
  7. 2209392Species Bacillus subtilis [TaxId:1423] [143707] (1 PDB entry)
    Uniprot O32248 5-156
  8. 2209396Domain d1yvkd2: 1yvk D:5-155 [124104]
    Other proteins in same PDB: d1yvka2, d1yvkb3, d1yvkc3, d1yvkd3
    automated match to d1yvka1
    complexed with coa

Details for d1yvkd2

PDB Entry: 1yvk (more details), 3.01 Å

PDB Description: crystal structure of the bacillis subtilis acetyltransferase in complex with coa, northeast structural genomics target sr237.
PDB Compounds: (D:) hypothetical protein BSU33890

SCOPe Domain Sequences for d1yvkd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvkd2 d.108.1.1 (D:5-155) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]}
klrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktrpqtv
eivniavkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgfriqa
idhdfflrhydedifengiqcrdmvrlyldl

SCOPe Domain Coordinates for d1yvkd2:

Click to download the PDB-style file with coordinates for d1yvkd2.
(The format of our PDB-style files is described here.)

Timeline for d1yvkd2: