Lineage for d1yvib_ (1yvi B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700189Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 2700197Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)
  6. 2700198Protein Histidine-containing phosphotransfer protein HP1 [140413] (1 species)
  7. 2700199Species Rice (Oryza sativa) [TaxId:4530] [140414] (2 PDB entries)
    Uniprot Q6VAK4 2-143
  8. 2700203Domain d1yvib_: 1yvi B: [124100]
    Other proteins in same PDB: d1yvia2
    automated match to d1yvia1

Details for d1yvib_

PDB Entry: 1yvi (more details), 2 Å

PDB Description: x-ray structure of putative histidine-containing phosphotransfer protein from rice, ak104879
PDB Compounds: (B:) histidine-containing phosphotransfer protein

SCOPe Domain Sequences for d1yvib_:

Sequence, based on SEQRES records: (download)

>d1yvib_ a.24.10.2 (B:) Histidine-containing phosphotransfer protein HP1 {Rice (Oryza sativa) [TaxId: 4530]}
aaalrdqltallssmfsqglvdeqfqqlqmlqdeggtpgfvsevvtlfcddadriineia
tlleqpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavvrn
dfydlrnkfqtmlqleqqiq

Sequence, based on observed residues (ATOM records): (download)

>d1yvib_ a.24.10.2 (B:) Histidine-containing phosphotransfer protein HP1 {Rice (Oryza sativa) [TaxId: 4530]}
aaalrdqltallssmfsqglvdeqfqqlqmlqdpgfvsevvtlfcddadriineiatlle
qpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavvrndfyd
lrnkfqtmlqleqqiq

SCOPe Domain Coordinates for d1yvib_:

Click to download the PDB-style file with coordinates for d1yvib_.
(The format of our PDB-style files is described here.)

Timeline for d1yvib_: