Lineage for d1yvia1 (1yvi A:2-143)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638124Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (5 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 638132Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)
  6. 638133Protein Histidine-containing phosphotransfer protein HP1 [140413] (1 species)
  7. 638134Species Rice (Oryza sativa) [TaxId:4530] [140414] (2 PDB entries)
  8. 638135Domain d1yvia1: 1yvi A:2-143 [124099]

Details for d1yvia1

PDB Entry: 1yvi (more details), 2 Å

PDB Description: x-ray structure of putative histidine-containing phosphotransfer protein from rice, ak104879
PDB Compounds: (A:) histidine-containing phosphotransfer protein

SCOP Domain Sequences for d1yvia1:

Sequence, based on SEQRES records: (download)

>d1yvia1 a.24.10.2 (A:2-143) Histidine-containing phosphotransfer protein HP1 {Rice (Oryza sativa) [TaxId: 4530]}
aaaalrdqltallssmfsqglvdeqfqqlqmlqdeggtpgfvsevvtlfcddadriinei
atlleqpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavvr
ndfydlrnkfqtmlqleqqiqa

Sequence, based on observed residues (ATOM records): (download)

>d1yvia1 a.24.10.2 (A:2-143) Histidine-containing phosphotransfer protein HP1 {Rice (Oryza sativa) [TaxId: 4530]}
aaaalrdqltallssmfsqglvdeqfqqlqmlqdtpgfvsevvtlfcddadriineiatl
leqpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavvrndf
ydlrnkfqtmlqleqqiqa

SCOP Domain Coordinates for d1yvia1:

Click to download the PDB-style file with coordinates for d1yvia1.
(The format of our PDB-style files is described here.)

Timeline for d1yvia1: