Lineage for d1yvha3 (1yvh A:264-351)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965338Protein Cbl [55587] (1 species)
  7. 2965339Species Human (Homo sapiens) [TaxId:9606] [55588] (12 PDB entries)
  8. 2965344Domain d1yvha3: 1yvh A:264-351 [124098]
    Other proteins in same PDB: d1yvha1, d1yvha2
    automatically matched to d1fbva3
    complexed with mg

Details for d1yvha3

PDB Entry: 1yvh (more details), 2.05 Å

PDB Description: Crystal Structure of the c-Cbl TKB Domain in Complex with the APS pTyr-618 Phosphopeptide
PDB Compounds: (A:) CBL E3 ubiquitin protein ligase

SCOPe Domain Sequences for d1yvha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvha3 d.93.1.1 (A:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdltg

SCOPe Domain Coordinates for d1yvha3:

Click to download the PDB-style file with coordinates for d1yvha3.
(The format of our PDB-style files is described here.)

Timeline for d1yvha3: