Lineage for d1yvha2 (1yvh A:48-177)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1997956Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 1997957Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (2 families) (S)
    automatically mapped to Pfam PF02262
  5. 1997958Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein)
  6. 1997959Protein N-terminal domain of cbl (N-cbl) [47670] (1 species)
  7. 1997960Species Human (Homo sapiens) [TaxId:9606] [47671] (10 PDB entries)
  8. 1997966Domain d1yvha2: 1yvh A:48-177 [124097]
    Other proteins in same PDB: d1yvha1, d1yvha3
    automatically matched to d1b47a2
    complexed with mg

Details for d1yvha2

PDB Entry: 1yvh (more details), 2.05 Å

PDB Description: Crystal Structure of the c-Cbl TKB Domain in Complex with the APS pTyr-618 Phosphopeptide
PDB Compounds: (A:) CBL E3 ubiquitin protein ligase

SCOPe Domain Sequences for d1yvha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvha2 a.48.1.1 (A:48-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]}
pgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkme
tlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelkg
ifpsglfqgd

SCOPe Domain Coordinates for d1yvha2:

Click to download the PDB-style file with coordinates for d1yvha2.
(The format of our PDB-style files is described here.)

Timeline for d1yvha2: