![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
![]() | Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (2 families) ![]() automatically mapped to Pfam PF02262 |
![]() | Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein) |
![]() | Protein N-terminal domain of cbl (N-cbl) [47670] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47671] (13 PDB entries) |
![]() | Domain d1yvha2: 1yvh A:48-177 [124097] Other proteins in same PDB: d1yvha1, d1yvha3 automatically matched to d1b47a2 complexed with mg |
PDB Entry: 1yvh (more details), 2.05 Å
SCOPe Domain Sequences for d1yvha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvha2 a.48.1.1 (A:48-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]} pgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkme tlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelkg ifpsglfqgd
Timeline for d1yvha2: