Lineage for d1yvca1 (1yvc A:1-69)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668717Family b.40.4.12: TRAM domain [101768] (3 proteins)
    Pfam PF01938
  6. 668721Protein Hypothetical protein MMP0076 [141313] (1 species)
  7. 668722Species Methanococcus maripaludis [TaxId:39152] [141314] (1 PDB entry)
  8. 668723Domain d1yvca1: 1yvc A:1-69 [124094]

Details for d1yvca1

PDB Entry: 1yvc (more details)

PDB Description: Solution structure of the conserved protein from the gene locus MMP0076 of Methanococcus maripaludis. Northeast Structural Genomics target MrR5.
PDB Compounds: (A:) MrR5

SCOP Domain Sequences for d1yvca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvca1 b.40.4.12 (A:1-69) Hypothetical protein MMP0076 {Methanococcus maripaludis [TaxId: 39152]}
mafgkpamknvpveagkeyevtiedmgkggdgiaridgfvvfvpnaekgsvinvkvtavk
ekfafaerv

SCOP Domain Coordinates for d1yvca1:

Click to download the PDB-style file with coordinates for d1yvca1.
(The format of our PDB-style files is described here.)

Timeline for d1yvca1: