Lineage for d1yvca1 (1yvc A:1-69)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790356Family b.40.4.12: TRAM domain [101768] (3 proteins)
    Pfam PF01938
  6. 2790360Protein Hypothetical protein MMP0076 [141313] (1 species)
  7. 2790361Species Methanococcus maripaludis [TaxId:39152] [141314] (1 PDB entry)
    Uniprot Q6M142 1-69
  8. 2790362Domain d1yvca1: 1yvc A:1-69 [124094]

Details for d1yvca1

PDB Entry: 1yvc (more details)

PDB Description: solution structure of the conserved protein from the gene locus mmp0076 of methanococcus maripaludis. northeast structural genomics target mrr5.
PDB Compounds: (A:) MrR5

SCOPe Domain Sequences for d1yvca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvca1 b.40.4.12 (A:1-69) Hypothetical protein MMP0076 {Methanococcus maripaludis [TaxId: 39152]}
mafgkpamknvpveagkeyevtiedmgkggdgiaridgfvvfvpnaekgsvinvkvtavk
ekfafaerv

SCOPe Domain Coordinates for d1yvca1:

Click to download the PDB-style file with coordinates for d1yvca1.
(The format of our PDB-style files is described here.)

Timeline for d1yvca1: