SCOPe 2.02: Domain d1yvbi_: 1yvb I:

Lineage for d1yvbi_ (1yvb I:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (7 proteins)

6. Protein automated matches [190165] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186890] (1 PDB entry)

8. Domain d1yvbi_: 1yvb I: [124093]
   Other proteins in same PDB: d1yvba1
   automated match to d1a67__
   complexed with gol

Details for d1yvbi_

PDB Entry: 1yvb, 2.7 Å

PDB Description: the plasmodium falciparum cysteine protease falcipain-2

PDB Compounds: (I:) cystatin

SCOPe Domain Sequences for d1yvbi_:

Sequence; same for both SEQRES and ATOM records:

>d1yvbi_ d.17.1.2 (I:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rllgapvpvdendeglqralqfamaeynrasndkyssrvvrvisakrqlvsgikyilqve
igrttcpkssgdlqscefhdepemakyttctfvvysipwlnqiklleskcq

Timeline for d1yvbi_:

• d1yvbi_ first appeared in SCOP 1.73, called d1yvbi1
  
• d1yvbi_ appears in SCOPe 2.01
  
• d1yvbi_ appears in SCOPe 2.03
  
• d1yvbi_ appears in the current release, SCOPe 2.08