Lineage for d1yvbi_ (1yvb I:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196747Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1196748Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 1196781Family d.17.1.2: Cystatins [54407] (7 proteins)
  6. 1196842Protein automated matches [190165] (2 species)
    not a true protein
  7. 1196843Species Chicken (Gallus gallus) [TaxId:9031] [186890] (1 PDB entry)
  8. 1196844Domain d1yvbi_: 1yvb I: [124093]
    Other proteins in same PDB: d1yvba1
    automated match to d1a67__
    complexed with gol

Details for d1yvbi_

PDB Entry: 1yvb (more details), 2.7 Å

PDB Description: the plasmodium falciparum cysteine protease falcipain-2
PDB Compounds: (I:) cystatin

SCOPe Domain Sequences for d1yvbi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvbi_ d.17.1.2 (I:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rllgapvpvdendeglqralqfamaeynrasndkyssrvvrvisakrqlvsgikyilqve
igrttcpkssgdlqscefhdepemakyttctfvvysipwlnqiklleskcq

SCOPe Domain Coordinates for d1yvbi_:

Click to download the PDB-style file with coordinates for d1yvbi_.
(The format of our PDB-style files is described here.)

Timeline for d1yvbi_: