Lineage for d1yvbi1 (1yvb I:9-116)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 718641Superfamily d.17.1: Cystatin/monellin [54403] (5 families) (S)
    has a additional strand at the N-terminus
  5. 718665Family d.17.1.2: Cystatins [54407] (6 proteins)
  6. 718666Protein Cystatin [54410] (1 species)
  7. 718667Species Chicken (Gallus gallus) [TaxId:9031] [54411] (4 PDB entries)
  8. 718669Domain d1yvbi1: 1yvb I:9-116 [124093]
    Other proteins in same PDB: d1yvba1
    automatically matched to d1a67__
    complexed with gol

Details for d1yvbi1

PDB Entry: 1yvb (more details), 2.7 Å

PDB Description: the plasmodium falciparum cysteine protease falcipain-2
PDB Compounds: (I:) cystatin

SCOP Domain Sequences for d1yvbi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvbi1 d.17.1.2 (I:9-116) Cystatin {Chicken (Gallus gallus) [TaxId: 9031]}
gapvpvdendeglqralqfamaeynrasndkyssrvvrvisakrqlvsgikyilqveigr
ttcpkssgdlqscefhdepemakyttctfvvysipwlnqiklleskcq

SCOP Domain Coordinates for d1yvbi1:

Click to download the PDB-style file with coordinates for d1yvbi1.
(The format of our PDB-style files is described here.)

Timeline for d1yvbi1: