Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.2: Cystatins [54407] (7 proteins) automatically mapped to Pfam PF00031 |
Protein automated matches [190165] (2 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [186890] (1 PDB entry) |
Domain d1yvbi_: 1yvb I: [124093] Other proteins in same PDB: d1yvba1 automated match to d1a67__ complexed with gol |
PDB Entry: 1yvb (more details), 2.7 Å
SCOPe Domain Sequences for d1yvbi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvbi_ d.17.1.2 (I:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} rllgapvpvdendeglqralqfamaeynrasndkyssrvvrvisakrqlvsgikyilqve igrttcpkssgdlqscefhdepemakyttctfvvysipwlnqiklleskcq
Timeline for d1yvbi_: