Lineage for d1yv9a1 (1yv9 A:4-256)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712516Family c.108.1.14: NagD-like [102317] (6 proteins)
    duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family
  6. 712527Protein Putative hydrolase EF1188 [142173] (1 species)
  7. 712528Species Enterococcus faecalis [TaxId:1351] [142174] (1 PDB entry)
  8. 712529Domain d1yv9a1: 1yv9 A:4-256 [124089]
    complexed with po4

Details for d1yv9a1

PDB Entry: 1yv9 (more details), 2.8 Å

PDB Description: Crystal structure of a HAD-like phosphatase from Enterococcus faecalis V583
PDB Compounds: (A:) hydrolase, haloacid dehalogenase family

SCOP Domain Sequences for d1yv9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]}
dyqgylidldgtiylgkepipagkrfverlqekdlpflfvtnnttkspetvaqrlanefd
ihvpaslvytatlatidymkeanrgkkvfvigeaglidlileagfewdetnpdyvvvgld
telsyekvvlatlaiqkgalfigtnpdkniptergllpgagsvvtfvetatqtkpvyigk
pkaiimeraiahlgvekeqvimvgdnyetdiqsgiqngidsllvtsgftpksavptlptp
ptyvvdsldewtf

SCOP Domain Coordinates for d1yv9a1:

Click to download the PDB-style file with coordinates for d1yv9a1.
(The format of our PDB-style files is described here.)

Timeline for d1yv9a1: