Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1yv1a1 (1yv1 A:1-166)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. Protein Nigerythrin, N-terminal domain [140440] (1 species)
  7. Species Desulfovibrio vulgaris [TaxId:881] [140441] (3 PDB entries)
    Uniprot P30820 1-166
  8. Domain d1yv1a1: 1yv1 A:1-166 [124084]
    Other proteins in same PDB: d1yv1a2, d1yv1b2
    automatically matched to 1YUX A:1-166
    complexed with fe2

Details for d1yv1a1

PDB Entry: 1yv1 (more details)
PDB Description: fully reduced state of nigerythrin (all ferrous)
PDB Compounds: (A:) Nigerythrin

SCOP Domain Sequences for d1yv1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yv1a1 a.25.1.1 (A:1-166) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
mkvraqvptvknatnfnmvadsktsvgstlenlkaaiagetgahakytafakaareqgye
qiarlfeataaaelihigleyalvaemepgyekptvaapsayscdlnlisgangeiyets
dmypafirkaqeegnskavhvftraklaesvhaerylaayndidap

SCOP Domain Coordinates for d1yv1a1:

Click to download the PDB-style file with coordinates for d1yv1a1.
(The format of our PDB-style files is described here.)

Timeline for d1yv1a1:

d1yv1a1 appears in SCOP 1.75A


d1yv1a1
(click for larger image)


d1yv1a1 in context of chain
Domains from same chain:
d1yv1a2


d1yv1a1 in context of PDB
Domains from other chains:
d1yv1b1, d1yv1b2

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu