Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) form heterodimeric coiled coil |
Family h.1.25.2: Troponin I [90254] (1 protein) |
Protein Troponin I [90255] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [144263] (2 PDB entries) Uniprot P68246 3-118! Uniprot P68246 3-143 |
Domain d1yv0i1: 1yv0 I:3-118 [124082] Other proteins in same PDB: d1yv0c1, d1yv0t1 complexed with mg |
PDB Entry: 1yv0 (more details), 7 Å
SCOPe Domain Sequences for d1yv0i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yv0i1 h.1.25.2 (I:3-118) Troponin I {Chicken (Gallus gallus) [TaxId: 9031]} eekkrraatarrqhlksamlqlavteiekeaaakevekqnylaehspplslpgsmqelqe lskklhakidsvdeerydtevklqktnkeledlsqklfdlrgkfkrpplrrvrmsa
Timeline for d1yv0i1: