SCOPe 2.05: Domain d1yv0c1: 1yv0 C:3-161

Lineage for d1yv0c1 (1yv0 C:3-161)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
   Uniprot P09860

8. Domain d1yv0c1: 1yv0 C:3-161 [124081]
   Other proteins in same PDB: d1yv0i1, d1yv0t1
   automatically matched to d1ncx__
   complexed with mg

Details for d1yv0c1

PDB Entry: 1yv0, 7 Å

PDB Description: crystal structure of skeletal muscle troponin in the ca2+-free state

PDB Compounds: (C:) troponin c, skeletal muscle

SCOPe Domain Sequences for d1yv0c1:

Sequence, based on SEQRES records:

>d1yv0c1 a.39.1.5 (C:3-161) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
tdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiie
evdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelgeilr
atgehvteediedlmkdsdknndgridfdeflkmmegvq

Sequence, based on observed residues (ATOM records):

>d1yv0c1 a.39.1.5 (C:3-161) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
tdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiie
evdedgsgtidfeeflvmmvrqelancfrifdknadgfidieelgeilratgehvteedi
edlmkdsdknndgridfdeflkmmegvq

Timeline for d1yv0c1:

• d1yv0c1 first appeared in SCOP 1.73
  
• d1yv0c1 appears in SCOPe 2.04
  
• d1yv0c1 appears in SCOPe 2.06
  
• d1yv0c1 appears in the current release, SCOPe 2.08