Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d1yuza1 (1yuz A:23-157)

  1. Root: SCOP 1.75
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (9 protein domains)
  6. Protein Nigerythrin, N-terminal domain [140440] (1 species)
  7. Species Desulfovibrio vulgaris [TaxId:881] [140441] (3 PDB entries)
    Uniprot P30820 1-166
  8. Domain d1yuza1: 1yuz A:23-157 [124077]
    Other proteins in same PDB: d1yuza2, d1yuzb2
    complexed with fe, fe2

Details for d1yuza1

PDB Entry: 1yuz (more details)
PDB Description: partially reduced state of nigerythrin
PDB Compounds: (A:) Nigerythrin

SCOP Domain Sequences for d1yuza1:

Sequence, based on SEQRES records: (download)

>d1yuza1 a.25.1.1 (A:23-157) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
ktavgstlenlkaaiagetgahakytafakaareqgyeqiarlfeataaaelihigleya
lvaemepgyekptvaapsayscdlnlisgangeiyetsdmypafirkaqeegnskavhvf
traklaesvhaeryl

Sequence, based on observed residues (ATOM records): (download)
>d1yuza1 a.25.1.1 (A:23-157) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
ktavgstlenlkaaiagetgahakytafakaareqgyeqiarlfeataaaelihigleya
lvaemepgyekptvpsayscdlnlisgangeiyetsdmypafirkaqeegnskavhvftr
aklaesvhaeryl

SCOP Domain Coordinates for d1yuza1:

Click to download the PDB-style file with coordinates for d1yuza1.
(The format of our PDB-style files is described here.)

Timeline for d1yuza1:

d1yuza1 appears in SCOP 1.73
d1yuza1 appears in SCOP 1.75A


d1yuza1
(click for larger image)


d1yuza1 in context of chain
Domains from same chain:
d1yuza2


d1yuza1 in context of PDB
Domains from other chains:
d1yuzb1, d1yuzb2

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu