Lineage for d1yuxb1 (1yux B:1-166)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315275Protein Nigerythrin, N-terminal domain [140440] (1 species)
  7. 2315276Species Desulfovibrio vulgaris [TaxId:881] [140441] (3 PDB entries)
    Uniprot P30820 1-166
  8. 2315282Domain d1yuxb1: 1yux B:1-166 [124075]
    Other proteins in same PDB: d1yuxa2, d1yuxb2
    automated match to d1yuxa1
    complexed with fe, fe2

Details for d1yuxb1

PDB Entry: 1yux (more details), 1.6 Å

PDB Description: Mixed valant state of nigerythrin
PDB Compounds: (B:) Nigerythrin

SCOPe Domain Sequences for d1yuxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuxb1 a.25.1.1 (B:1-166) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
mkvraqvptvknatnfnmvadsktsvgstlenlkaaiagetgahakytafakaareqgye
qiarlfeataaaelihigleyalvaemepgyekptvaapsayscdlnlisgangeiyets
dmypafirkaqeegnskavhvftraklaesvhaerylaayndidap

SCOPe Domain Coordinates for d1yuxb1:

Click to download the PDB-style file with coordinates for d1yuxb1.
(The format of our PDB-style files is described here.)

Timeline for d1yuxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yuxb2