Lineage for d1yuxa1 (1yux A:1-166)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 639032Protein Nigerythrin, N-terminal domain [140440] (1 species)
  7. 639033Species Desulfovibrio vulgaris [TaxId:881] [140441] (3 PDB entries)
  8. 639038Domain d1yuxa1: 1yux A:1-166 [124073]
    Other proteins in same PDB: d1yuxa2, d1yuxb2
    complexed with fe, fe2; mutant

Details for d1yuxa1

PDB Entry: 1yux (more details), 1.6 Å

PDB Description: Mixed valant state of nigerythrin
PDB Compounds: (A:) Nigerythrin

SCOP Domain Sequences for d1yuxa1:

Sequence, based on SEQRES records: (download)

>d1yuxa1 a.25.1.1 (A:1-166) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
mkvraqvptvknatnfnmvadsktsvgstlenlkaaiagetgahakytafakaareqgye
qiarlfeataaaelihigleyalvaemepgyekptvaapsayscdlnlisgangeiyets
dmypafirkaqeegnskavhvftraklaesvhaerylaayndidap

Sequence, based on observed residues (ATOM records): (download)

>d1yuxa1 a.25.1.1 (A:1-166) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
mkvraqvptvknatnfnmvadsktsvgstlenlkaaiagetgahakytafakaareqgye
qiarlfeataaaelihigleyalvaemepgyekptvpsayscdlnlisgangeiyetsdm
ypafirkaqeegnskavhvftraklaesvhaerylaayndidap

SCOP Domain Coordinates for d1yuxa1:

Click to download the PDB-style file with coordinates for d1yuxa1.
(The format of our PDB-style files is described here.)

Timeline for d1yuxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yuxa2