Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
Protein Calcyclin (S100) [47479] (17 species) |
Species Human (Homo sapiens), s100a13 [TaxId:9606] [140535] (4 PDB entries) Uniprot Q99584 1-98 |
Domain d1yuua1: 1yuu A:1-98 [124068] automatically matched to 1YUR A:1-98 complexed with ca |
PDB Entry: 1yuu (more details)
SCOPe Domain Sequences for d1yuua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yuua1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm ksldvnqdselkfneywrligelakeirkkkdlkirkk
Timeline for d1yuua1: