Lineage for d1yuua1 (1yuu A:1-98)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 914095Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 914096Protein Calcyclin (S100) [47479] (17 species)
  7. 914160Species Human (Homo sapiens), s100a13 [TaxId:9606] [140535] (4 PDB entries)
    Uniprot Q99584 1-98
  8. 914165Domain d1yuua1: 1yuu A:1-98 [124068]
    automatically matched to 1YUR A:1-98
    complexed with ca

Details for d1yuua1

PDB Entry: 1yuu (more details)

PDB Description: solution structure of calcium-s100a13
PDB Compounds: (A:) S100 calcium-binding protein A13

SCOPe Domain Sequences for d1yuua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuua1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk

SCOPe Domain Coordinates for d1yuua1:

Click to download the PDB-style file with coordinates for d1yuua1.
(The format of our PDB-style files is described here.)

Timeline for d1yuua1: