SCOP 1.73: Domain d1yuua1: 1yuu A:1-98

Lineage for d1yuua1 (1yuu A:1-98)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (1 protein)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), s100a13 [TaxId:9606] [140535] (4 PDB entries)

8. Domain d1yuua1: 1yuu A:1-98 [124068]
   automatically matched to 1YUR A:1-98
   complexed with ca

Details for d1yuua1

PDB Entry: 1yuu

PDB Description: solution structure of calcium-s100a13

PDB Compounds: (A:) S100 calcium-binding protein A13

SCOP Domain Sequences for d1yuua1:

Sequence; same for both SEQRES and ATOM records:

>d1yuua1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk

Timeline for d1yuua1:

• d1yuua1 is new in SCOP 1.73
  
• d1yuua1 appears in SCOP 1.75
  
• d1yuua1 appears in the current release, SCOPe 2.08, called d1yuua_