SCOPe 2.06: Domain d1yutb_: 1yut B:

Lineage for d1yutb_ (1yut B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (30 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (51 PDB entries)

8. Domain d1yutb_: 1yut B: [124067]
   automated match to d2h2ka_
   complexed with ca

Details for d1yutb_

PDB Entry: 1yut

PDB Description: solution structure of calcium-s100a13 (minimized mean structure)

PDB Compounds: (B:) S100 calcium-binding protein A13

SCOPe Domain Sequences for d1yutb_:

Sequence; same for both SEQRES and ATOM records:

>d1yutb_ a.39.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk

Timeline for d1yutb_:

• d1yutb_ first appeared in SCOP 1.73, called d1yutb1
  
• d1yutb_ appears in SCOPe 2.05
  
• d1yutb_ appears in SCOPe 2.07
  
• d1yutb_ appears in the current release, SCOPe 2.08