Lineage for d1yutb_ (1yut B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1995633Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1995634Protein automated matches [190513] (28 species)
    not a true protein
  7. 1995680Species Human (Homo sapiens) [TaxId:9606] [189519] (44 PDB entries)
  8. 1995749Domain d1yutb_: 1yut B: [124067]
    automated match to d2h2ka_
    complexed with ca

Details for d1yutb_

PDB Entry: 1yut (more details)

PDB Description: Solution structure of Calcium-S100A13 (minimized mean structure)
PDB Compounds: (B:) S100 calcium-binding protein A13

SCOPe Domain Sequences for d1yutb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yutb_ a.39.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk

SCOPe Domain Coordinates for d1yutb_:

Click to download the PDB-style file with coordinates for d1yutb_.
(The format of our PDB-style files is described here.)

Timeline for d1yutb_: