Lineage for d1yuta_ (1yut A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. Protein automated matches [190513] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [189519] (56 PDB entries)
  8. Domain d1yuta_: 1yut A: [124066]
    automated match to d2h2ka_
    complexed with ca

Details for d1yuta_

PDB Entry: 1yut (more details)

PDB Description: Solution structure of Calcium-S100A13 (minimized mean structure)
PDB Compounds: (A:) S100 calcium-binding protein A13

SCOPe Domain Sequences for d1yuta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuta_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk

SCOPe Domain Coordinates for d1yuta_ are not available.

Timeline for d1yuta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yutb_