Lineage for d1yusb1 (1yus B:1-98)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 640684Family a.39.1.2: S100 proteins [47478] (1 protein)
    dimer: subunits are made of two EF-hands
  6. 640685Protein Calcyclin (S100) [47479] (17 species)
  7. 640733Species Human (Homo sapiens), s100a13 [TaxId:9606] [140535] (4 PDB entries)
  8. 640739Domain d1yusb1: 1yus B:1-98 [124065]
    automatically matched to 1YUR A:1-98

Details for d1yusb1

PDB Entry: 1yus (more details)

PDB Description: solution structure of apo-s100a13
PDB Compounds: (B:) S100 calcium binding protein A13

SCOP Domain Sequences for d1yusb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yusb1 a.39.1.2 (B:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk

SCOP Domain Coordinates for d1yusb1:

Click to download the PDB-style file with coordinates for d1yusb1.
(The format of our PDB-style files is described here.)

Timeline for d1yusb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yusa1