Lineage for d1yurb1 (1yur B:1-98)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1087651Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1087652Protein Calcyclin (S100) [47479] (17 species)
  7. 1087718Species Human (Homo sapiens), s100a13 [TaxId:9606] [140535] (5 PDB entries)
    Uniprot Q99584 1-98
  8. 1087723Domain d1yurb1: 1yur B:1-98 [124063]
    automatically matched to 1YUR A:1-98

Details for d1yurb1

PDB Entry: 1yur (more details)

PDB Description: Solution structure of apo-S100A13 (minimized mean structure)
PDB Compounds: (B:) S100 calcium-binding protein A13

SCOPe Domain Sequences for d1yurb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yurb1 a.39.1.2 (B:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk

SCOPe Domain Coordinates for d1yurb1:

Click to download the PDB-style file with coordinates for d1yurb1.
(The format of our PDB-style files is described here.)

Timeline for d1yurb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yura1