Lineage for d1yupg_ (1yup G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2414280Protein automated matches [190163] (13 species)
    not a true protein
  7. 2414358Species Reindeer (Rangifer tarandus) [TaxId:9870] [186888] (1 PDB entry)
  8. 2414363Domain d1yupg_: 1yup G: [124061]
    Other proteins in same PDB: d1yupa1, d1yupe_, d1yuph_
    automated match to d1bsqa_

Details for d1yupg_

PDB Entry: 1yup (more details), 2.1 Å

PDB Description: reindeer beta-lactoglobulin
PDB Compounds: (G:) beta-lactoglobulin

SCOPe Domain Sequences for d1yupg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yupg_ b.60.1.1 (G:) automated matches {Reindeer (Rangifer tarandus) [TaxId: 9870]}
vtqtmkdldvqkvagtwyslamaasdislldaqsaplrvyveelkptpggdleillqkwe
ngkcaqkkiiaekteipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqcl
vrtpevddeamekfdkalkalpmhirlsfnptqleeqcrv

SCOPe Domain Coordinates for d1yupg_:

Click to download the PDB-style file with coordinates for d1yupg_.
(The format of our PDB-style files is described here.)

Timeline for d1yupg_: