SCOPe 2.08: Domain d1yupg_: 1yup G:

Lineage for d1yupg_ (1yup G:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Reindeer (Rangifer tarandus) [TaxId:9870] [186888] (1 PDB entry)

8. Domain d1yupg_: 1yup G: [124061]
   Other proteins in same PDB: d1yupa1, d1yupe_, d1yuph_
   automated match to d1bsqa_

Details for d1yupg_

PDB Entry: 1yup, 2.1 Å

PDB Description: reindeer beta-lactoglobulin

PDB Compounds: (G:) beta-lactoglobulin

SCOPe Domain Sequences for d1yupg_:

Sequence; same for both SEQRES and ATOM records:

>d1yupg_ b.60.1.1 (G:) automated matches {Reindeer (Rangifer tarandus) [TaxId: 9870]}
vtqtmkdldvqkvagtwyslamaasdislldaqsaplrvyveelkptpggdleillqkwe
ngkcaqkkiiaekteipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqcl
vrtpevddeamekfdkalkalpmhirlsfnptqleeqcrv

Timeline for d1yupg_:

• d1yupg_ first appeared in SCOP 1.73, called d1yupg1
  
• d1yupg_ appears in SCOPe 2.07