![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
![]() | Protein automated matches [190163] (13 species) not a true protein |
![]() | Species Reindeer (Rangifer tarandus) [TaxId:9870] [186888] (1 PDB entry) |
![]() | Domain d1yupf_: 1yup F: [124060] Other proteins in same PDB: d1yupa1, d1yupe_, d1yuph_ automated match to d1bsqa_ |
PDB Entry: 1yup (more details), 2.1 Å
SCOPe Domain Sequences for d1yupf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yupf_ b.60.1.1 (F:) automated matches {Reindeer (Rangifer tarandus) [TaxId: 9870]} ivtqtmkdldvqkvagtwyslamaasdislldaqsaplrvyveelkptpggdleillqkw engkcaqkkiiaekteipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc lvrtpevddeamekfdkalkalpmhirlsfnptqleeqc
Timeline for d1yupf_: