Lineage for d1yupf1 (1yup F:2-160)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805867Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 805868Superfamily b.60.1: Lipocalins [50814] (9 families) (S)
    bind hydrophobic ligands in their interior
  5. 805869Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
    barrel, closed; n=8, S=12, meander
  6. 805892Protein beta-Lactoglobulin [50827] (3 species)
  7. 805923Species Reindeer (Rangifer tarandus) [TaxId:9870] [141461] (1 PDB entry)
    Uniprot P02755 19-180
  8. 805928Domain d1yupf1: 1yup F:2-160 [124060]
    automatically matched to 1YUP A:1-162

Details for d1yupf1

PDB Entry: 1yup (more details), 2.1 Å

PDB Description: reindeer beta-lactoglobulin
PDB Compounds: (F:) beta-lactoglobulin

SCOP Domain Sequences for d1yupf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yupf1 b.60.1.1 (F:2-160) beta-Lactoglobulin {Reindeer (Rangifer tarandus) [TaxId: 9870]}
ivtqtmkdldvqkvagtwyslamaasdislldaqsaplrvyveelkptpggdleillqkw
engkcaqkkiiaekteipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
lvrtpevddeamekfdkalkalpmhirlsfnptqleeqc

SCOP Domain Coordinates for d1yupf1:

Click to download the PDB-style file with coordinates for d1yupf1.
(The format of our PDB-style files is described here.)

Timeline for d1yupf1: