Lineage for d1yupd_ (1yup D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. Protein automated matches [190163] (13 species)
    not a true protein
  7. Species Reindeer (Rangifer tarandus) [TaxId:9870] [186888] (1 PDB entry)
  8. Domain d1yupd_: 1yup D: [124059]
    Other proteins in same PDB: d1yupa1, d1yupe_, d1yuph_
    automated match to d1bsqa_

Details for d1yupd_

PDB Entry: 1yup (more details), 2.1 Å

PDB Description: reindeer beta-lactoglobulin
PDB Compounds: (D:) beta-lactoglobulin

SCOPe Domain Sequences for d1yupd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yupd_ b.60.1.1 (D:) automated matches {Reindeer (Rangifer tarandus) [TaxId: 9870]}
vtqtmkdldvqkvagtwyslamaasdislldaqsaplrvyveelkptpggdleillqkwe
ngkcaqkkiiaekteipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqcl
vrtpevddeamekfdkalkalpmhirlsfnptqleeqc

SCOPe Domain Coordinates for d1yupd_ are not available.

Timeline for d1yupd_:

Domains from other chains:
(mouse over for more information)
d1yupa1, d1yupb_, d1yupc_, d1yupe_, d1yupf_, d1yupg_, d1yuph_