SCOP 1.75: Domain d1yupc1: 1yup C:3-162

Lineage for d1yupc1 (1yup C:3-162)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (9 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (3 species)

7. Species Reindeer (Rangifer tarandus) [TaxId:9870] [141461] (1 PDB entry)
   Uniprot P02755 19-180

8. Domain d1yupc1: 1yup C:3-162 [124058]
   automatically matched to 1YUP A:1-162

Details for d1yupc1

PDB Entry: 1yup, 2.1 Å

PDB Description: reindeer beta-lactoglobulin

PDB Compounds: (C:) beta-lactoglobulin

SCOP Domain Sequences for d1yupc1:

Sequence; same for both SEQRES and ATOM records:

>d1yupc1 b.60.1.1 (C:3-162) beta-Lactoglobulin {Reindeer (Rangifer tarandus) [TaxId: 9870]}
vtqtmkdldvqkvagtwyslamaasdislldaqsaplrvyveelkptpggdleillqkwe
ngkcaqkkiiaekteipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqcl
vrtpevddeamekfdkalkalpmhirlsfnptqleeqcrv

Timeline for d1yupc1:

• d1yupc1 first appeared in SCOP 1.73
  
• d1yupc1 is called d1yupc_ in SCOPe 2.01
  
• d1yupc1 appears in the current release, SCOPe 2.08, called d1yupc_