Lineage for d1yupa1 (1yup A:1-162)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673647Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
    barrel, closed; n=8, S=12, meander
  6. 673670Protein beta-Lactoglobulin [50827] (3 species)
  7. 673694Species Reindeer (Rangifer tarandus) [TaxId:9870] [141461] (1 PDB entry)
  8. 673695Domain d1yupa1: 1yup A:1-162 [124056]

Details for d1yupa1

PDB Entry: 1yup (more details), 2.1 Å

PDB Description: reindeer beta-lactoglobulin
PDB Compounds: (A:) beta-lactoglobulin

SCOP Domain Sequences for d1yupa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yupa1 b.60.1.1 (A:1-162) beta-Lactoglobulin {Reindeer (Rangifer tarandus) [TaxId: 9870]}
iivtqtmkdldvqkvagtwyslamaasdislldaqsaplrvyveelkptpggdleillqk
wengkcaqkkiiaekteipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddeamekfdkalkalpmhirlsfnptqleeqcrv

SCOP Domain Coordinates for d1yupa1:

Click to download the PDB-style file with coordinates for d1yupa1.
(The format of our PDB-style files is described here.)

Timeline for d1yupa1: