Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.16: YML079-like [117318] (4 proteins) Pfam PF06172; DUF985 |
Protein automated matches [190840] (1 species) not a true protein |
Species Shewanella oneidensis [TaxId:211586] [188155] (1 PDB entry) |
Domain d1yudc_: 1yud C: [124048] Other proteins in same PDB: d1yuda1 automated match to d1yuda1 |
PDB Entry: 1yud (more details), 2.7 Å
SCOPe Domain Sequences for d1yudc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yudc_ b.82.1.16 (C:) automated matches {Shewanella oneidensis [TaxId: 211586]} mqnaddfikfleleqhveggfyrssyrsetafdpsrqlwssiyfllrtgevshfhrltad emwyfhagqsltiymispegelttaqlgldlaagerpqflvpkgcifgsamnqdgfslvg cmvspgftfddfelfsqeallamypqhkavvqklsrpe
Timeline for d1yudc_: