Lineage for d1yudb1 (1yud B:1-158)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677267Superfamily b.82.1: RmlC-like cupins [51182] (20 families) (S)
  5. 677617Family b.82.1.16: YML079-like [117318] (3 proteins)
    Pfam PF06172; DUF985
  6. 677627Protein Hypothetical protein SO0799 [141607] (1 species)
  7. 677628Species Shewanella oneidensis [TaxId:70863] [141608] (1 PDB entry)
  8. 677630Domain d1yudb1: 1yud B:1-158 [124047]
    automatically matched to 1YUD A:1-158

Details for d1yudb1

PDB Entry: 1yud (more details), 2.7 Å

PDB Description: X-ray Crystal Structure of Protein SO0799 from Shewanella oneidensis. Northeast Structural Genomics Consortium Target SoR12.
PDB Compounds: (B:) hypothetical protein SO0799

SCOP Domain Sequences for d1yudb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yudb1 b.82.1.16 (B:1-158) Hypothetical protein SO0799 {Shewanella oneidensis [TaxId: 70863]}
mqnaddfikfleleqhveggfyrssyrsetafdpsrqlwssiyfllrtgevshfhrltad
emwyfhagqsltiymispegelttaqlgldlaagerpqflvpkgcifgsamnqdgfslvg
cmvspgftfddfelfsqeallamypqhkavvqklsrpe

SCOP Domain Coordinates for d1yudb1:

Click to download the PDB-style file with coordinates for d1yudb1.
(The format of our PDB-style files is described here.)

Timeline for d1yudb1: