SCOPe 2.07: Domain d1yu9a1: 1yu9 A:2-172

Lineage for d1yu9a1 (1yu9 A:2-172)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab4a [142247] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142248] (3 PDB entries)
   Uniprot P20338 2-172! Uniprot P20338 4-172! Uniprot P20338 4-184

8. Domain d1yu9a1: 1yu9 A:2-172 [124045]
   Other proteins in same PDB: d1yu9a2
   complexed with gnp, mg, so4

Details for d1yu9a1

PDB Entry: 1yu9, 2.07 Å

PDB Description: GppNHp-Bound Rab4A

PDB Compounds: (A:) GTP-binding protein

SCOPe Domain Sequences for d1yu9a1:

Sequence; same for both SEQRES and ATOM records:

>d1yu9a1 c.37.1.8 (A:2-172) Rab4a {Human (Homo sapiens) [TaxId: 9606]}
setydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqi
wdtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgn
kkdldadrevtfleasrfaqenelmfletsaltgedveeafvqcarkilnk

Timeline for d1yu9a1:

• d1yu9a1 first appeared in SCOP 1.73
  
• d1yu9a1 appears in SCOPe 2.06
  
• d1yu9a1 appears in the current release, SCOPe 2.08