Lineage for d1yu5x_ (1yu5 X:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725340Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 1725341Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) (S)
  5. 1725342Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins)
  6. 1725352Protein Villin [47052] (2 species)
  7. 1725353Species Chicken (Gallus gallus) [TaxId:9031] [47053] (13 PDB entries)
  8. 1725354Domain d1yu5x_: 1yu5 X: [124039]
    automated match to d1qqva_

Details for d1yu5x_

PDB Entry: 1yu5 (more details), 1.4 Å

PDB Description: Crystal Structure of the Headpiece Domain of Chicken Villin
PDB Compounds: (X:) villin

SCOPe Domain Sequences for d1yu5x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yu5x_ a.14.1.1 (X:) Villin {Chicken (Gallus gallus) [TaxId: 9031]}
ptkletfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafanlplwkqqnl
kkekglf

SCOPe Domain Coordinates for d1yu5x_:

Click to download the PDB-style file with coordinates for d1yu5x_.
(The format of our PDB-style files is described here.)

Timeline for d1yu5x_: