SCOPe 2.07: Domain d1yu4c2: 1yu4 C:171-380

Lineage for d1yu4c2 (1yu4 C:171-380)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.8: Mtd variable domain [143964] (1 protein)
   fold decorated with many additional structures; overall similarity to the Sulfatase modifying factor family; lacks the characteristic disulfide

6. Protein Major tropism determinant (Mtd), C-terminal domain [143965] (1 species)

7. Species Bordetella phage bpp-1 [TaxId:194699] [143966] (6 PDB entries)
   Uniprot Q775D6 171-380
   includes related Bordetella phage proteins

8. Domain d1yu4c2: 1yu4 C:171-380 [124038]
   Other proteins in same PDB: d1yu4a1, d1yu4b1, d1yu4c1
   automated match to d1yu4a2
   complexed with mg

Details for d1yu4c2

PDB Entry: 1yu4, 1.87 Å

PDB Description: Major Tropism Determinant U1 Variant

PDB Compounds: (C:) Major Tropism Determinant (Mtd-U1)

SCOPe Domain Sequences for d1yu4c2:

Sequence; same for both SEQRES and ATOM records:

>d1yu4c2 d.169.1.8 (C:171-380) Major tropism determinant (Mtd), C-terminal domain {Bordetella phage bpp-1 [TaxId: 194699]}
kfrpaaldprgmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgs
aaysdgawynfaevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsaw
niftskwgvvqasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggnwnstsn
sgsraanwnsgpsnspanigargvcdhlil

Timeline for d1yu4c2:

• d1yu4c2 first appeared in SCOP 1.73
  
• d1yu4c2 appears in SCOPe 2.06
  
• d1yu4c2 appears in the current release, SCOPe 2.08