SCOP 1.73: Domain d1yu3a2: 1yu3 A:171-380

Lineage for d1yu3a2 (1yu3 A:171-380)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.8: Mtd variable domain [143964] (1 protein)
   fold decorated with many additional structures; overall similarity to the Sulfatase modifying factor family; lacks the characteristic disulfide

6. Protein Major tropism determinant (Mtd), C-terminal domain [143965] (1 species)

7. Species Bordetella phage bpp-1 [TaxId:194699] [143966] (5 PDB entries)
   includes related Bordetella phage proteins

8. Domain d1yu3a2: 1yu3 A:171-380 [124032]
   Other proteins in same PDB: d1yu3a1
   complexed with mg

Details for d1yu3a2

PDB Entry: 1yu3, 2.52 Å

PDB Description: Major Tropism Determinant I1 Variant

PDB Compounds: (A:) Major Tropism Determinant (Mtd-I1)

SCOP Domain Sequences for d1yu3a2:

Sequence; same for both SEQRES and ATOM records:

>d1yu3a2 d.169.1.8 (A:171-380) Major tropism determinant (Mtd), C-terminal domain {Bordetella phage bpp-1 [TaxId: 194699]}
kfrpaaldprgmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgs
aaysdgawynfaevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsaw
niftskwgvvqasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggswfytsy
sgsraaywnagpsnssanigargvcdhlil

Timeline for d1yu3a2:

• d1yu3a2 is new in SCOP 1.73
  
• d1yu3a2 appears in SCOP 1.75
  
• d1yu3a2 appears in the current release, SCOPe 2.08